Medicago
BLAST2 result
TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC139600.9 - phase: 0 /pseudo
         (145 letters)

Database: LJGI 
           28,460 sequences; 14,692,800 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

BP064363                                                               25  5.3

>BP064363 
          Length = 527

 Score = 25.0 bits (53), Expect = 5.3
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +1

Query: 84  MWPKLEALYMTKSLTHQQFLKQ*LYSFKMV 113
           MW  L  + MT ++THQ    + L +FK V
Sbjct: 316 MWTSLHKVPMTIAITHQNLEYKVLLAFKEV 405


  Database: LJGI
    Posted date:  Jul 30, 2004 11:16 AM
  Number of letters in database: 14,692,800
  Number of sequences in database:  28,460
  
Lambda     K      H
   0.322    0.135    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,705,124
Number of Sequences: 28460
Number of extensions: 14884
Number of successful extensions: 52
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of query: 145
length of database: 4,897,600
effective HSP length: 82
effective length of query: 63
effective length of database: 2,563,880
effective search space: 161524440
effective search space used: 161524440
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)


Medicago: description of AC139600.9