
BLAST2 result
TBLASTN 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= AC139600.9 - phase: 0 /pseudo
(145 letters)
Database: LJGI
28,460 sequences; 14,692,800 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BP064363 25 5.3
>BP064363
Length = 527
Score = 25.0 bits (53), Expect = 5.3
Identities = 12/30 (40%), Positives = 17/30 (56%)
Frame = +1
Query: 84 MWPKLEALYMTKSLTHQQFLKQ*LYSFKMV 113
MW L + MT ++THQ + L +FK V
Sbjct: 316 MWTSLHKVPMTIAITHQNLEYKVLLAFKEV 405
Database: LJGI
Posted date: Jul 30, 2004 11:16 AM
Number of letters in database: 14,692,800
Number of sequences in database: 28,460
Lambda K H
0.322 0.135 0.377
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,705,124
Number of Sequences: 28460
Number of extensions: 14884
Number of successful extensions: 52
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of query: 145
length of database: 4,897,600
effective HSP length: 82
effective length of query: 63
effective length of database: 2,563,880
effective search space: 161524440
effective search space used: 161524440
frameshift window, decay const: 50, 0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)
Medicago: description of AC139600.9