TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC149050.7 + phase: 0 /pseudo
         (887 letters)

Database: GMGI 
           63,676 sequences; 37,918,896 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

BM527432 weakly similar to GP|21928131|gb| At2g29210/F16P2.41 {A...    32  1.6

>BM527432 weakly similar to GP|21928131|gb| At2g29210/F16P2.41 {Arabidopsis
           thaliana}, partial (2%)
          Length = 421

 Score = 31.6 bits (70), Expect = 1.6
 Identities = 15/35 (42%), Positives = 21/35 (59%)
 Frame = +1

Query: 52  QALQTRVETERRKGYEIAPNVQKWLYDVTTIENEL 86
           QAL+T +     K  EIA N++K L D TT +N +
Sbjct: 220 QALETEINATLEKAEEIAGNIKKMLDDPTTTKNAM 324


  Database: GMGI
    Posted date:  Oct 22, 2004  4:58 PM
  Number of letters in database: 37,918,896
  Number of sequences in database:  63,676
  
Lambda     K      H
   0.362    0.160    0.608 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,752,510
Number of Sequences: 63676
Number of extensions: 690268
Number of successful extensions: 7013
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3785
Number of HSP's successfully gapped in prelim test: 225
Number of HSP's that attempted gapping in prelim test: 3131
Number of HSP's gapped (non-prelim): 4207
length of query: 887
length of database: 12,639,632
effective HSP length: 106
effective length of query: 781
effective length of database: 5,889,976
effective search space: 4600071256
effective search space used: 4600071256
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 14 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.9 bits)
S2: 63 (28.9 bits)