Lotus japonicus (Chloroplast)
BLAST2 result
TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB33214.1	31 aa
         (31 letters)

Database: MTGI 
           36,976 sequences; 27,044,181 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

TC85922 similar to SP|P56807|RR18_ARATH Chloroplast 30S ribosoma...    54  1e-08

>TC85922 similar to SP|P56807|RR18_ARATH Chloroplast 30S ribosomal protein
           S18. [Mouse-ear cress] {Arabidopsis thaliana}, partial
           (74%)
          Length = 3196

 Score = 53.9 bits (128), Expect = 1e-08
 Identities = 27/31 (87%), Positives = 29/31 (93%)
 Frame = +1

Query: 1   MPTITSYFGFLLAVLTITSGLFISLRKLRLI 31
           M TITSYFGFLLAVLTIT+GLFISL K+RLI
Sbjct: 634 MLTITSYFGFLLAVLTITAGLFISLNKIRLI 726


  Database: MTGI
    Posted date:  Oct 22, 2004  3:39 PM
  Number of letters in database: 27,044,181
  Number of sequences in database:  36,976
  
Lambda     K      H
   0.338    0.151    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 762,302
Number of Sequences: 36976
Number of extensions: 3915
Number of successful extensions: 59
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 59
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59
length of query: 31
length of database: 9,014,727
effective HSP length: 7
effective length of query: 24
effective length of database: 8,755,895
effective search space: 210141480
effective search space used: 210141480
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 52 (24.6 bits)


Description of BAB33214.1