BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0403.5
         (44 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

POL1_TRSVB (Q88893) RNA1 polyprotein (P1) [Contains: P1A protein...    28  6.2

>POL1_TRSVB (Q88893) RNA1 polyprotein (P1) [Contains: P1A protein (1A)
            (Protease cofactor); NTP-binding protein (NTB) (1B)
            (Membrane-binding protein); Viral genome-linked protein
            (1C-VPg); 3C-like protease (EC 3.4.22.-) (1D-PRO);
            RNA-directed RNA polymera
          Length = 2304

 Score = 27.7 bits (60), Expect = 6.2
 Identities = 13/35 (37%), Positives = 21/35 (59%), Gaps = 3/35 (8%)

Query: 13   PGGFFVWSTTPVY---HKLPEDVEICNGMSSLLCI 44
            PG + +   T VY   HKL E+V++  G+  ++CI
Sbjct: 1652 PGAYTLKPGTSVYNDYHKLQEEVQVEGGIPEMVCI 1686


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.325    0.146    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,855,185
Number of Sequences: 164201
Number of extensions: 147362
Number of successful extensions: 395
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 395
Number of HSP's gapped (non-prelim): 1
length of query: 44
length of database: 59,974,054
effective HSP length: 20
effective length of query: 24
effective length of database: 56,690,034
effective search space: 1360560816
effective search space used: 1360560816
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 59 (27.3 bits)