BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0322.4
         (153 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

HELZ_HUMAN (P42694) Potential helicase with zinc-finger domain         29  4.6

>HELZ_HUMAN (P42694) Potential helicase with zinc-finger domain
          Length = 1942

 Score = 28.9 bits (63), Expect = 4.6
 Identities = 19/64 (29%), Positives = 31/64 (47%), Gaps = 3/64 (4%)

Query: 7   MEIQTSGRPIESLLEKVLCMNILSSDYFKELYRLKTYLEVIDEIYNQV---DHVEPWMAG 63
           M+++   +P+ ++L K L    L+    K+L RLKT L   +   +      HVE    G
Sbjct: 102 MQLKGKLQPVSTILAKSLTGESLNGMVTKDLTRLKTLLSETETATSNALSGYHVEDLDEG 161

Query: 64  NCRG 67
           +C G
Sbjct: 162 SCNG 165


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.352    0.162    0.599 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,727,506
Number of Sequences: 164201
Number of extensions: 615187
Number of successful extensions: 2518
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2518
Number of HSP's gapped (non-prelim): 1
length of query: 153
length of database: 59,974,054
effective HSP length: 101
effective length of query: 52
effective length of database: 43,389,753
effective search space: 2256267156
effective search space used: 2256267156
T: 11
A: 40
X1: 14 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.9 bits)
S2: 61 (28.1 bits)