BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0111b.9
         (341 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ATC3_SCHPO (P22189) Calcium-transporting ATPase 3 (EC 3.6.3.8)         30  8.7

>ATC3_SCHPO (P22189) Calcium-transporting ATPase 3 (EC 3.6.3.8)
          Length = 1037

 Score = 30.0 bits (66), Expect = 8.7
 Identities = 24/54 (44%), Positives = 26/54 (47%), Gaps = 6/54 (11%)

Query: 225 HSEAYGH*SCYCEEWRRSLGLEA*SGVSTWLVKVIRGFLRAQCQPLPLKLALGF 278
           H EA    S Y E       LEA SGVS W V ++R  L A C  L L  AL F
Sbjct: 32  HEEAQNRLSEYGEN-----RLEADSGVSAWKV-LLRQVLNAMCVVLILAAALSF 79


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.358    0.162    0.621 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,910,032
Number of Sequences: 164201
Number of extensions: 1170205
Number of successful extensions: 3985
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3985
Number of HSP's gapped (non-prelim): 1
length of query: 341
length of database: 59,974,054
effective HSP length: 111
effective length of query: 230
effective length of database: 41,747,743
effective search space: 9601980890
effective search space used: 9601980890
T: 11
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.7 bits)
S2: 66 (30.0 bits)