BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0066.5
         (667 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

YE18_SULTO (Q971D5) Hypothetical UPF0173 metal-dependent hydrola...    32  7.0

>YE18_SULTO (Q971D5) Hypothetical UPF0173 metal-dependent hydrolase
           ST1418
          Length = 227

 Score = 31.6 bits (70), Expect = 7.0
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 355 KKVPEKLGGLHNYDGIRKALIKAVYETLKISEFEAAWGIMIQRFGVS-DHEWLRSLYEDR 413
           + +P  +GG  ++DGI+ AL KAV+     SE     G ++   GV+  H     L+ED 
Sbjct: 92  RMIPANVGGYIDFDGIKLALTKAVHS----SEHSDPTGAIVSGEGVTIYHAGDTGLFEDM 147

Query: 414 VRWAPVFLKD 423
                +F  D
Sbjct: 148 KLIGEIFKPD 157


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.322    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 81,478,859
Number of Sequences: 164201
Number of extensions: 3545029
Number of successful extensions: 7178
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7178
Number of HSP's gapped (non-prelim): 1
length of query: 667
length of database: 59,974,054
effective HSP length: 117
effective length of query: 550
effective length of database: 40,762,537
effective search space: 22419395350
effective search space used: 22419395350
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)