Lotus
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0036c.5
         (55 letters)

Database: nr 
           2,540,612 sequences; 863,360,394 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAA73364.1| Pge1 protein [Lotus corniculatus var. japonicus]       61  7e-09

>emb|CAA73364.1| Pge1 protein [Lotus corniculatus var. japonicus]
          Length = 210

 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 26/43 (60%), Positives = 34/43 (78%)

Query: 3   VFDWAQLVGKNNDFVVIMIRSDYGTLNGKESLTLGCEQGGKFK 45
           + DWA+ VGK N +VVI+IRSDYG+   K  +TLGCE+GGK+K
Sbjct: 163 LIDWARCVGKENGYVVIVIRSDYGSAKRKPLITLGCERGGKYK 205


  Database: nr
    Posted date:  Jul 5, 2005 12:34 AM
  Number of letters in database: 863,360,394
  Number of sequences in database:  2,540,612
  
Lambda     K      H
   0.322    0.143    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 101,365,138
Number of Sequences: 2540612
Number of extensions: 3029915
Number of successful extensions: 4410
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4409
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 863,360,394
effective HSP length: 31
effective length of query: 24
effective length of database: 784,601,422
effective search space: 18830434128
effective search space used: 18830434128
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)


Lotus: description of TM0036c.5