TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0221.5
         (190 letters)

Database: GMGI 
           63,676 sequences; 37,918,896 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

TC234972                                                               27  7.4

>TC234972 
          Length = 919

 Score = 26.6 bits (57), Expect = 7.4
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +1

Query: 123 QRTYITKVLKGFYMDKSCPLCTLLILRSLNVNKDPFR 159
           Q ++  K+ +G    + CP   LL L SLN +  P R
Sbjct: 94  QISHCKKITRGMQKGRECPNLNLLHLLSLNKSNPPKR 204


  Database: GMGI
    Posted date:  Oct 22, 2004  4:58 PM
  Number of letters in database: 37,918,896
  Number of sequences in database:  63,676
  
Lambda     K      H
   0.359    0.163    0.534 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,462,604
Number of Sequences: 63676
Number of extensions: 85745
Number of successful extensions: 955
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 955
length of query: 190
length of database: 12,639,632
effective HSP length: 92
effective length of query: 98
effective length of database: 6,781,440
effective search space: 664581120
effective search space used: 664581120
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 14 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.8 bits)
S2: 56 (26.2 bits)