hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpm/mpm08299/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4243 ( 565 res) mpm08299 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HMG DNA-binding domain, high mobility group prot 105.8 5.1e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HMG 1/1 162 232 .. 1 71 [] 105.8 5.1e-27 Alignments of top-scoring domains: HMG: domain 1 of 1, from 162 to 232: score 105.8, E = 5.1e-27 *->kpKrPmsafmlFsqenRakikkenPdlknaeisKklgerWkeLseee ++KrPm+afm+++q R+k+ +++P+l+nae+sK+lg++W++L e+e mKIAA4243 162 HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESE 208 KapYeekAekdkeryekempeykk<-* K p+ e+Ae+++++++k++p+yk+ mKIAA4243 209 KRPFVEEAERLRVQHKKDHPDYKY 232 //