hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpm/mpm08299/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4243 ( 565 res) mpm08299 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HMG_box HMG (high mobility group) box 121.1 2.1e-32 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HMG_box 1/1 163 231 .. 1 69 [] 121.1 2.1e-32 Alignments of top-scoring domains: HMG_box: domain 1 of 1, from 163 to 231: score 121.1, E = 2.1e-32 *->PKRPlsAFflfrqeqRakikaenPglsnaeIskklGekWkaLseeeK +KRP++AF++++q+ R+k++ + P+l+nae+sk+lG++W+ L e+eK mKIAA4243 163 VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEK 209 apYeakAekeKarYekempeYk<-* +p++++Ae+++++++k++p+Yk mKIAA4243 210 RPFVEEAERLRVQHKKDHPDYK 231 //