hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj17080/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4237 ( 519 res) mfj17080 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- zf-C2H2 Zinc finger, C2H2 type 277.8 1.4e-79 11 KRAB KRAB box 92.0 1.2e-23 1 zf-BED BED zinc finger 9.7 0.29 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- KRAB 1/1 8 48 .. 1 41 [] 92.0 1.2e-23 zf-C2H2 1/11 188 210 .. 1 24 [] 36.9 4.6e-07 zf-C2H2 2/11 243 265 .. 1 24 [] 32.0 1.4e-05 zf-C2H2 3/11 271 293 .. 1 24 [] 30.0 5.4e-05 zf-C2H2 4/11 299 321 .. 1 24 [] 33.9 3.8e-06 zf-C2H2 5/11 327 349 .. 1 24 [] 30.3 4.5e-05 zf-C2H2 6/11 355 377 .. 1 24 [] 28.2 0.00019 zf-C2H2 7/11 383 405 .. 1 24 [] 28.7 0.00014 zf-BED 1/1 368 406 .. 1 52 [] 9.7 0.29 zf-C2H2 8/11 411 433 .. 1 24 [] 35.6 1.1e-06 zf-C2H2 9/11 439 461 .. 1 24 [] 32.8 8e-06 zf-C2H2 10/11 467 489 .. 1 24 [] 23.4 0.0052 zf-C2H2 11/11 497 519 .] 1 24 [] 33.7 4.2e-06 Alignments of top-scoring domains: KRAB: domain 1 of 1, from 8 to 48: score 92.0, E = 1.2e-23 *->VtFeDVAVdFtqEEWglLdpaQrnLYrdVMlENyrnLvSlg<-* V+FeDV VdFtqEEW L+p QrnLYrdVMlENy+nL+ +g mKIAA4237 8 VSFEDVIVDFTQEEWSSLNPDQRNLYRDVMLENYQNLATVG 48 zf-C2H2: domain 1 of 11, from 188 to 210: score 36.9, E = 4.6e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ dCgksF ++s+L++H+rtH mKIAA4237 188 FECS-DCGKSFMSQSHLQTHQRTH 210 zf-C2H2: domain 2 of 11, from 243 to 265: score 32.0, E = 1.4e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk ++ ++ L+ H+rtH mKIAA4237 243 HRCK-ECGKGYRYPAYLNIHMRTH 265 zf-C2H2: domain 3 of 11, from 271 to 293: score 30.0, E = 5.4e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+ + +++ H rtH mKIAA4237 271 YECK-ECGKAFNYSNSFQIHGRTH 293 zf-C2H2: domain 4 of 11, from 299 to 321: score 33.9, E = 3.8e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+++s L H r+H mKIAA4237 299 YVCS-QCGKAFTQHSGLSIHVRSH 321 zf-C2H2: domain 5 of 11, from 327 to 349: score 30.3, E = 4.5e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ +Cgk+F ++s L +H+rtH mKIAA4237 327 YGCK-ECGKAFLTSSRLIQHIRTH 349 zf-C2H2: domain 6 of 11, from 355 to 377: score 28.2, E = 0.00019 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C +Cgk+F +snL+ Hl+ H mKIAA4237 355 FVCV-KCGKAFAISSNLNGHLKLH 377 zf-C2H2: domain 7 of 11, from 383 to 405: score 28.7, E = 0.00014 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+F s L++H+rtH mKIAA4237 383 CECK-ICGKAFGYLSCLNNHMRTH 405 zf-BED: domain 1 of 1, from 368 to 406: score 9.7, E = 0.29 *->SkvWkhFtkveeeedgkevegkakCkhCgkklsrkkksGTsnLirHL S++ h ++ ee++ ++Ck+Cgk + + s+L++H+ mKIAA4237 368 SNLNGHLKLH-AEEKT------CECKICGKAFGYL-----SCLNNHM 402 rrkHp<-* r H mKIAA4237 403 R-THN 406 zf-C2H2: domain 8 of 11, from 411 to 433: score 35.6, E = 1.1e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+ + +Lk H+r+H mKIAA4237 411 YTCK-ECGKAFNYSTHLKIHMRIH 433 zf-C2H2: domain 9 of 11, from 439 to 461: score 32.8, E = 8e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs++ +++ H rtH mKIAA4237 439 YECK-QCGKAFSHSTSFQIHERTH 461 zf-C2H2: domain 10 of 11, from 467 to 489: score 23.4, E = 0.0052 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F +s+++ H +H mKIAA4237 467 YECK-ECGKAFICPSSFRIHEISH 489 zf-C2H2: domain 11 of 11, from 497 to 519: score 33.7, E = 4.2e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ +Cgk++s++ +L+rH r+H mKIAA4237 497 YKCQ-QCGKAYSHPRSLRRHERIH 519 //