hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh03361/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4217 ( 310 res) mbh03361 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Copine Copine 322.3 5.6e-93 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Copine 1/1 75 219 .. 1 160 [] 322.3 5.6e-93 Alignments of top-scoring domains: Copine: domain 1 of 1, from 75 to 219: score 322.3, E = 5.6e-93 *->SLHyIspyqpNpYeqAiravGeiLqdYDsDklfpayGFGAkiPpdys SLHy+spyq+++Y +A+ avGei+qdYDsDklfpayGFGAk+Pp+++ mKIAA4217 75 SLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGR 121 vshdedvFpLnfnpedpeCnGieGVleaYrealpnvqLsGPTnFaPiIna +sh+ FpLn n+edp+C GieGVle+Y ++l++vqL+GPT FaP+In+ mKIAA4217 122 ISHQ---FPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQ 168 aariAeassaqeggqYhVLlIiTDGqvtRsvDteGLSpDmkeTvdAIVsA +ar A++ + +g+qY+VLlIiTDG+++ Dm +T++AIVsA mKIAA4217 169 VARAAAK--ISDGSQYYVLLIITDGVIS----------DMTQTKEAIVSA 206 SklPLSIiiVGVG<-* S+lP+SIiiVGVG mKIAA4217 207 SSLPMSIIIVGVG 219 //