hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mie/mie24089/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4200 ( 414 res) mie24089 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DEP Domain found in Dishevelled, Egl-10, and Ple 156.8 2.2e-42 2 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. 37.3 2e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DEP 1/2 50 124 .. 1 90 [] 85.0 8.9e-21 DEP 2/2 151 224 .. 1 90 [] 73.2 3.1e-17 PDZ 1/1 343 412 .. 1 80 [] 37.3 2e-06 Alignments of top-scoring domains: DEP: domain 1 of 2, from 50 to 124: score 85.0, E = 8.9e-21 *->pesglklddrkyflktypncFtGselVdWLldnlegqsnngptkttf +e +++d r+++lktypncF+ +el+dWL+++ e mKIAA4200 50 HEEKVIKD-RRHHLKTYPNCFVAKELIDWLIEHKE------------ 83 iidreeAvhlgqaLlkeGlihhvndpnkhtFkdsknalYrFtd<-* +dre A++l+q+L++ G ihhv + + Fkd + +YrF++ mKIAA4200 84 ASDRETAIKLMQKLADRGIIHHVC-DEHKEFKDV-KLFYRFRK 124 DEP: domain 2 of 2, from 151 to 224: score 73.2, E = 3.1e-17 *->pesglklddrkyflktypncFtGselVdWLldnlegqsnngptkttf pe++l + r++ + +y+ +F+ se+ dWL++ +e mKIAA4200 151 PETTLLQP-REEEGVKYERTFMASEFLDWLVQEGE------------ 184 iidreeAvhlgqaLlkeGlihhvndpnkhtFkdsknalYrFtd<-* +r+eA+ l+ +L+++G i+hv+ nkh+F ds n lY+F+ mKIAA4200 185 ATTRKEAEQLCHRLMDHGIIQHVS--NKHPFVDS-NLLYQFRM 224 PDZ: domain 1 of 1, from 343 to 412: score 37.3, E = 2e-06 *->gglGfsivg..gifvssvvpGspAakaGrkslglLkvGDvIleVNGe g+Gf ++g++++ + v p +pAa aG +kv +++VNG mKIAA4200 343 VGWGFVVRGskPCHIQAVDPSGPAAAAG------MKVCQFVVSVNG- 382 tsvegltheeavdllkkaggggvGekvtLtvlRgg<-* +v ++++ + +l+ ++ +++++v + mKIAA4200 383 LNVLNVDYRTVSNLILTGPR-----TIVMEVMEEL 412 //