hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg03549/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4185 ( 578 res) mbg03549 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Death Death domain 96.0 7.5e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Death 1/1 293 376 .. 1 87 [] 96.0 7.5e-25 Alignments of top-scoring domains: Death: domain 1 of 1, from 293 to 376: score 96.0, E = 7.5e-25 *->eklcallDpdellgkdWkeLArkLglseneIdeiesdenpgdlrspt + ++a++ +++lg +W+eLAr+L++s +eI++i+ enp++l s++ mKIAA4185 293 DIRMAIV--ADHLGLSWTELARELNFSVDEINQIRV-ENPNSLISQS 336 yeLLrlWeqrhGknatvgtLleaLrklgrrdaaellesal<-* +LL++W r Gknat ++L ++L+k++r d++ lle + mKIAA4185 337 FMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI 376 //