hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj02503/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4154 ( 702 res) mpj02503 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UBX UBX domain 118.1 1.6e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- UBX 1/1 620 700 .. 1 90 [] 118.1 1.6e-31 Alignments of top-scoring domains: UBX: domain 1 of 1, from 620 to 700: score 118.1, E = 1.6e-31 *->ekaedvcrlqiRlPDGsRlvrrFnssdtlqdvydfvdshrygadepe e+ae+v++l+iR+P+G++l+rrF++s++lq v+dfv+s+++++de mKIAA4154 620 ENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDE-- 664 dYkheFeFsLltpfPrrlltkldesktLkeagllpnstlvlep<-* F+Ll++fPrr +t+ld++k+L+e++l+p++tl+l++ mKIAA4154 665 -------FKLLSTFPRRDVTQLDPNKSLLEVNLFPQETLFLQA 700 //