hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/msj/msj06308/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4146 ( 616 res) msj06308 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 46.2 4.2e-09 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/2 532 562 .. 1 30 [] 32.3 6.6e-05 ANK 2/2 566 595 .. 1 30 [] 14.0 22 Alignments of top-scoring domains: ANK: domain 1 of 2, from 532 to 562: score 32.3, E = 6.6e-05 *->dGrTpLHlAaengnlevvklLldkga.dina<-* d rT+LH+Aa++g++evvk+L+++ ++ + mKIAA4146 532 DSRTALHVAAAEGHIEVVKFLIEACKvNPFV 562 ANK: domain 2 of 2, from 566 to 595: score 14.0, E = 22 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+ pL A++ ++levvklL d+ + + mKIAA4146 566 WGNIPLDDAVQFNHLEVVKLLQDYHDSYLL 595 //