hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg01377/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4145 ( 363 res) mbg01377 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Hormone_recep Ligand-binding domain of nuclear hormon 154.7 1.6e-42 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Hormone_recep 1/1 158 346 .. 1 200 [] 154.7 1.6e-42 Alignments of top-scoring domains: Hormone_recep: domain 1 of 1, from 158 to 346: score 154.7, E = 1.6e-42 *->frqlllivewaKslPfFkeLsleDQiiLLkhswlelllLrlayrsys +r l+l+++wa+s+P F+ L ++ +L++++w el+ L+la+++ mKIAA4145 158 SRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQV 204 lkkat..asdtllfpdGtdipresl....gsselierifeflvklrvnil + +t a+ + ++++ + ++ s+++ ++++e+i +++ef++++ mKIAA4145 205 MSLSTilAAIVNHLQNSIQEDKLSGdrikQVMEHIWKLQEFCNSMA---- 250 aplreLkldeeEyalLkAIvlfnPsdvpgLsesareiveklqekylsaLl +L++d Eya+LkAIvlf+P d pgL+ + ++ek qek++ +L+ mKIAA4145 251 ----KLDIDGYEYAYLKAIVLFSP-DHPGLTGTS--QIEKFQEKAQMELQ 293 qycllnypdtlssdgpsRFakLLlllpvlrsiskdllehlfflkqlfnvp +y++++y +++ R+a++L +lp+lr +s+++ e+lff +++ + mKIAA4145 294 DYVQKTYS-----EDTYRLARILVRLPALRLMSSNITEELFFTGLIG-NV 337 kvppLlkei<-* ++++++++i mKIAA4145 338 SIDSIIPYI 346 //