hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg17504/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4137 ( 832 res) mbg17504 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FN2 Fibronectin type 2 domain 96.5 3.2e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FN2 1/1 158 206 .. 1 49 [] 96.5 3.2e-24 Alignments of top-scoring domains: FN2: domain 1 of 1, from 158 to 206: score 96.5, E = 3.2e-24 *->gnsdGapCvFPFiYrGksYhdCTseGrndgmlWCsTTsnYDrDgkWg g+++G+pC+FPF++ k+Y++CTs+Gr+dg+lWC+TT +Y D+kWg mKIAA4137 158 GTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWG 204 fC<-* fC mKIAA4137 205 FC 206 //