hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpf/mpf00123/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4135 ( 723 res) mpf00123 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CUE Domain that may be involved in binding ubiqu 42.1 7.2e-08 1 ZnF_RBZ Zinc finger domain 34.9 1.1e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CUE 1/1 15 57 .. 1 43 [] 42.1 7.2e-08 ZnF_RBZ 1/1 696 720 .. 1 25 [] 34.9 1.1e-05 Alignments of top-scoring domains: CUE: domain 1 of 1, from 15 to 57: score 42.1, E = 7.2e-08 *->eneealsqlkemFPnldeevIeavLeantgnveatinnLLegs<-* ++l++l++ FP+++e+v+++++++n++n+ea++ +L ++s mKIAA4135 15 LDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQES 57 ZnF_RBZ: domain 1 of 1, from 696 to 720: score 34.9, E = 1.1e-05 *->gdWeCpaCtflNfasrskCfaCgap<-* W+C++CtflN++ ++C++C+ p mKIAA4135 696 APWNCDSCTFLNHPALNRCEQCEMP 720 //