hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg05860/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4123 ( 639 res) mbg05860 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- WD40 WD40 repeats 226.3 2.6e-63 7 FBOX A Receptor for Ubiquitination Targets 35.0 1e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FBOX 1/1 223 262 .. 1 41 [] 35.0 1e-05 WD40 1/7 326 363 .. 1 46 [] 24.6 0.014 WD40 2/7 366 403 .. 1 46 [] 44.4 1.5e-08 WD40 3/7 406 443 .. 1 46 [] 28.5 0.00093 WD40 4/7 449 486 .. 1 46 [] 38.5 8.8e-07 WD40 5/7 489 526 .. 1 46 [] 38.9 7e-07 WD40 6/7 529 566 .. 1 46 [] 37.8 1.5e-06 WD40 7/7 578 615 .. 1 46 [] 28.7 0.00083 Alignments of top-scoring domains: FBOX: domain 1 of 1, from 223 to 262: score 35.0, E = 1e-05 *->LPieileeIlskLdpkdllrlrkVsrkwrslidshdfwfkr<-* L +i e+Ils+Ld+k+l+++ +V++ w+++ ++ +w+k+ mKIAA4123 223 LD-HIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKL 262 WD40: domain 1 of 7, from 326 to 363: score 24.6, E = 0.014 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + + ++ + ++ +V+++++++ ++sg +D+ti++W mKIAA4123 326 SlQRIHCRSETSK--GVYCLQYDDQ--------KIVSGLrDNTIKIW 362 d<-* d mKIAA4123 363 D 363 WD40: domain 2 of 7, from 366 to 403: score 44.4, E = 1.5e-08 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW t ++ r+l+gHtg +V++++++ ++++gs+D+t+r+W mKIAA4123 366 TlECKRILTGHTG--SVLCLQYDER--------VIITGSsDSTVRVW 402 d<-* d mKIAA4123 403 D 403 WD40: domain 3 of 7, from 406 to 443: score 28.5, E = 0.00093 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW ++ l tl H +V++++f+ +++++s+D++i +W mKIAA4123 406 AgEMLNTLIHHCE--AVLHLRFNNG--------MMVTCSkDRSIAVW 442 d<-* d mKIAA4123 443 D 443 WD40: domain 4 of 7, from 449 to 486: score 38.5, E = 8.8e-07 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +l r+l gH++ +V+ v+f++ +++s+s+D+ti++W mKIAA4123 449 DiTLRRVLVGHRA--AVNVVDFDDK--------YIVSASgDRTIKVW 485 d<-* + mKIAA4123 486 N 486 WD40: domain 5 of 7, from 489 to 526: score 38.9, E = 7e-07 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW t + +rtl+gH+ ++ ++++ + l++sgs+D+tirlW mKIAA4123 489 TcEFVRTLNGHKR--GIACLQYRDR--------LVVSGSsDNTIRLW 525 d<-* d mKIAA4123 526 D 526 WD40: domain 6 of 7, from 529 to 566: score 37.8, E = 1.5e-06 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +lr+l+gH+ V++++f+ +++sg Dg+i++W mKIAA4123 529 CgACLRVLEGHEE--LVRCIRFDNK--------RIVSGAyDGKIKVW 565 d<-* d mKIAA4123 566 D 566 WD40: domain 7 of 7, from 578 to 615: score 28.7, E = 0.00083 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +lrtl H+g +V ++f+ +++s+s+D ti +W mKIAA4123 578 GtLCLRTLVEHSG--RVFRLQFDEF--------QIVSSShDDTILIW 614 d<-* d mKIAA4123 615 D 615 //