hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/TIGRFAMs_HMM.LIB
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg12536/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA4082  ( 615 res)   mbg12536

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PPR      PPR: pentatricopeptide repeat domain            28.4    0.00017   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PPR        1/1      31    65 ..     1    35 []    28.4  0.00017

Alignments of top-scoring domains:
PPR: domain 1 of 1, from 31 to 65: score 28.4, E = 0.00017
                   *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-*
                      v+Y +l+  +++  ++  A++++ eM+++Gi P++   
   mKIAA4082    31    VCYRILMQLCGQYDQPVLAVRVLFEMQKAGIDPNA    65   

//