hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh01667/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4076 ( 605 res) mbh01667 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAP2 PAP2 superfamily 79.4 7.4e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PAP2 1/1 20 173 .. 1 176 [] 79.4 7.4e-20 Alignments of top-scoring domains: PAP2: domain 1 of 1, from 20 to 173: score 79.4, E = 7.4e-20 *->aalallfalvasallnglaylKllfgrpRAPhflavcqpdwgd..st ++++f+l+a+al++++ ++l++g+ P+fl vc+p + + mKIAA4076 20 SSGVHVFGLCATALVTDV--IQLATGYHT-PFFLTVCKPNYTLlgTS 63 csdlwyeelyglefycmagspgldrid.lfgsvlltsafalvseggpSFP c+ ++ ++++ + +++ + ++++FP mKIAA4076 64 CES----------------------NPyITQDICSGHDTHAILSARKTFP 91 SGHaafaaaaalflalylprrlstls.rllrlllgllllllallvglSRv S Ha+++a+aa++++ y+ + + +++ll+++l++++++ a ++gl+ + mKIAA4076 92 SQHATLSAFAAVYVSMYFNA-VISDTtKLLKPILVFAFAIAAGVCGLTQI 140 ylgvHypsDVlaGallGaliallvllfvrrlld<-* + +p+DV aG+l+Ga+ia++ ++ ++++ mKIAA4076 141 TQYRSHPVDVYAGFLIGAGIAAYLACHAVGNFQ 173 //