hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj15040/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4063 ( 968 res) mfj15040 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Arm Armadillo/beta-catenin-like repeat 143.8 3e-39 6 HEAT HEAT repeat 32.4 1.1e-05 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Arm 1/6 356 395 .. 1 41 [] 3.0 34 HEAT 1/4 361 397 .. 1 36 [] 6.7 28 Arm 2/6 397 437 .. 1 41 [] 41.5 1.9e-08 HEAT 2/4 402 439 .. 1 36 [] 14.1 2.6 Arm 3/6 440 481 .. 1 41 [] 48.2 1.9e-10 Arm 4/6 541 588 .. 1 41 [] 3.8 27 Arm 5/6 658 699 .. 1 41 [] 26.5 0.00062 HEAT 3/4 664 701 .. 1 36 [] 3.0 94 Arm 6/6 705 745 .. 1 41 [] 25.7 0.0011 HEAT 4/4 711 747 .. 1 36 [] 12.9 3.9 Alignments of top-scoring domains: Arm: domain 1 of 6, from 356 to 395: score 3.0, E = 34 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* + + ++ lp + +L++p v+ +Aa+ L +L++ mKIAA4063 356 STRKEPRWRDP-ELPEVLAMLRHPVDPVKANAAAYLQHLCF 395 HEAT: domain 1 of 4, from 361 to 397: score 6.7, E = 28 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++d lp +l +l++p++ V+++Aa L++l+ mKIAA4063 361 PrWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFEN 397 Arm: domain 2 of 6, from 397 to 437: score 41.5, E = 1.9e-08 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* n+ k+ v+++ +lp+Lv LL++p ev++ A++AL+NL+ mKIAA4063 397 NEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSY 437 HEAT: domain 2 of 4, from 402 to 439: score 14.1, E = 2.6 *->e.lld.ellplllkllnDpdpeVReaAaeaLgalaevl<-* +++++ + lpll+ ll++p +eVR+ A+ aL +l+ mKIAA4063 402 RrVRQlRGLPLLVALLDHPRAEVRRRACGALRNLSYGR 439 Arm: domain 3 of 6, from 440 to 481: score 48.2, E = 1.9e-10 *->npenkqavveaGalppLvqLLs.spdeevqeeAawALsNLaa<-* + +nk a++++G++p+Lv+LL+ +d ev+e ++++L+NL++ mKIAA4063 440 DTDNKAAIRDCGGVPALVRLLRaARDNEVRELVTGTLWNLSS 481 Arm: domain 4 of 6, from 541 to 588: score 3.8, E = 27 *->npenkqavvea.GalppLvqLLs......spdeevqeeAawALsNLa +e ++ ++e++G + +L++ L++ +++++d + +e++++ ++NL+ mKIAA4063 541 GAEARRRLRECeGLVDALLHALQsavgrkDTDNKSVENCVCIMRNLS 587 a<-* mKIAA4063 588 Y 588 Arm: domain 5 of 6, from 658 to 699: score 26.5, E = 0.00062 *->npenkqavveaGalppLvqLLs.spdeevqeeAawALsNLaa<-* ++ +++ + ++++ ++LL++s++++++e+Aa+AL NL+a mKIAA4063 658 AAKGFELLYQPEVVRLYLSLLTeSRNFNTLEAAAGALQNLSA 699 HEAT: domain 3 of 4, from 664 to 701: score 3.0, E = 94 *->e.lldellplllklln.DpdpeVReaAaeaLgalaevl<-* +++e++ l l+ll+++ + + eaAa aL++l+ mKIAA4063 664 LlYQPEVVRLYLSLLTeSRNFNTLEAAAGALQNLSAGN 701 Arm: domain 6 of 6, from 705 to 745: score 25.7, E = 0.0011 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* + +v+++ +lp+Lv+LL+s+ +v++++a AL+NL+ mKIAA4063 705 ATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSL 745 HEAT: domain 4 of 4, from 711 to 747: score 12.9, E = 3.9 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++ lp+l++ll+++ ++V +a+a aL +l+ mKIAA4063 711 TvRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQ 747 //