hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpk/mpk01276/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4059 ( 219 res) mpk01276 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- NAC NAC domain 98.0 1.9e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- NAC 1/1 76 134 .. 1 60 [] 98.0 1.9e-25 Alignments of top-scoring domains: NAC: domain 1 of 1, from 76 to 134: score 98.0, E = 1.9e-25 *->ddkKlqmklkKLgmkqieGveEVnifkedgEivihfnkpeVqkslga +kK+++++ KLg++q+ Gv++V+i+k+++ i++++ kp+V+ks+++ mKIAA4059 76 SEKKARKAMSKLGLRQVTGVTRVTIRKSKN-ILFVITKPDVYKSPAS 121 nTyvvtGkakekd<-* +Ty+v+G+ak++d mKIAA4059 122 DTYIVFGEAKIED 134 //