hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mpm/mpm11085/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA4047  ( 1506 res)   mpm11085

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
HOX      Homeodomain                                     64.1    1.8e-14   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
HOX        1/1    1230  1292 ..     1    63 []    64.1  1.8e-14

Alignments of top-scoring domains:
HOX: domain 1 of 1, from 1230 to 1292: score 64.1, E = 1.8e-14
                   *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv
                       +++R ++ pe  e+L++++++ pYPs++++eeLA +L+L  + V +
   mKIAA4047  1230    LKKPRVVLAPEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVIN 1276 

                   WFQNRRakwkrqekkk<-*
                   WF N R + +r+   +   
   mKIAA4047  1277 WFHNYRSRIRRELFIE    1292 

//