hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mic/mic35030/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA4043 ( 522 res) mic35030 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- BBOX B-Box-type zinc finger, protein interaction 70.1 2.7e-16 2 RING Ring finger 29.9 0.00036 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RING 1/1 39 189 .. 1 23 [] 29.9 0.00036 BBOX 1/2 230 280 .. 1 51 [] 32.0 7.9e-05 BBOX 2/2 317 359 .. 1 51 [] 46.0 4.8e-09 Alignments of top-scoring domains: RING: domain 1 of 1, from 39 to 189: score 29.9, E = 0.00036 *->CpICle....pvvlpCgH.FCr.Ci...................... Cp+C + ++p++lpC H+ C +C ++ ++++++++ +++ ++ mKIAA4043 39 CPVCGSlfrePIILPCSHnVCLpCArtiavqtpdgeqhlppplllsr 85 .................................................. + ++++++ + ++++ + ++ ++ +++ ++++++ ++ + +++ mKIAA4043 86 gaaaaatppdqdaaagatsggagantagglgggatgggdhadklslyset 135 .................................................. +++ ++ +++ +++++ + + + +++++ ++ ++ +++++ + mKIAA4043 136 dsgygsytpslkspngvrvlpmvpappgssaaaargaacsslcsssssit 185 CPlC<-* CP+C mKIAA4043 186 CPQC 189 BBOX: domain 1 of 2, from 230 to 280: score 32.0, E = 7.9e-05 *->eraplCeeHgd..eepaeffCveedgallCrdCdeageHqanklfrg ++ C+ ++ ++ epa C e++++l+C++C + +H+ +++f++ mKIAA4043 230 PAVAICQLCDRtpPEPAATLC-EQCDVLYCATCQLK-CHPSRGPFAK 274 Hrvvll<-* Hr v mKIAA4043 275 HRLVQP 280 BBOX: domain 2 of 2, from 317 to 359: score 46.0, E = 4.8e-09 *->eraplCeeHgdeepaeffCveedgallCrdCdeageHqanklfrgHr ++ p C+eH+ e ++C ++++++ C+ C e+g H ++H+ mKIAA4043 317 RKFPTCPEHE-MENYSMYC-VSCRSPVCYMCLEEGRH------SKHE 355 vvll<-* v++l mKIAA4043 356 VKPL 359 //