hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mph/mph01327/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA3011  ( 496 res)   mph01327

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
ZnF_C2H2 zinc finger                                     82.6    4.7e-20   4
KRAB     krueppel associated box                         31.2    0.00014   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
KRAB       1/1     146   207 ..     1    62 []    31.2  0.00014
ZnF_C2H2   1/4     317   339 ..     1    23 []    28.4  0.00099
ZnF_C2H2   2/4     370   392 ..     1    23 []    17.8      1.5
ZnF_C2H2   3/4     428   450 ..     1    23 []    28.8  0.00073
ZnF_C2H2   4/4     456   478 ..     1    23 []    28.3    0.001

Alignments of top-scoring domains:
KRAB: domain 1 of 1, from 146 to 207: score 31.2, E = 0.00014
                   *->VtFeDVAVdFsqEEWeqLDpaQrnLYRdVMlENYsnLvSLGgfqvsk
                       ++e   V+Fs++EWe L+ +Q++LYR+VM  NY++LvSL +++ + 
   mKIAA3011   146    GSLENDGVCFSEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQPE 192  

                   pdliskLEqgeEpwi<-*
                    ++    E    +     
   mKIAA3011   193 EEVELGAEMVGDLVE    207  

ZnF_C2H2: domain 1 of 4, from 317 to 339: score 28.4, E = 0.00099
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      ykCp+ C+ sf+ k++L+ H+++H   
   mKIAA3011   317    YKCPE-CQISFRYKqQLTAHLQSH    339  

ZnF_C2H2: domain 2 of 4, from 370 to 392: score 17.8, E = 1.5
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      ++C++ C++sfs k +L+ H+r H   
   mKIAA3011   370    HQCDV-CHRSFSCKvSLVTHQRCH    392  

ZnF_C2H2: domain 3 of 4, from 428 to 450: score 28.8, E = 0.00073
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      + C + Cgksfs++++L+rH+r+H   
   mKIAA3011   428    LICGY-CGKSFSHPsDLVRHQRIH    450  

ZnF_C2H2: domain 4 of 4, from 456 to 478: score 28.3, E = 0.001
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      y Cp+ C ksf +k++L +H+++H   
   mKIAA3011   456    YSCPE-CEKSFVQKqHLLQHQKIH    478  

//