hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj31262/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA2011 ( 771 res) mfj31262 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Sec7 Sec7 domain 340.2 2.3e-98 1 PH PH domain 75.4 1.2e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Sec7 1/1 268 455 .. 1 221 [] 340.2 2.3e-98 PH 1/1 504 616 .. 1 92 [] 75.4 1.2e-18 Alignments of top-scoring domains: Sec7: domain 1 of 1, from 268 to 455: score 340.2, E = 2.3e-98 *->lksrkkqliegrkkFNqkPkkGiedLiskglladdkdpqdiAkfLle + s+ +++++++ +++++++ G++d++s+g++ad++++q++Ak+L+ mKIAA2011 268 PLSQLVSDSDSELDSTERLALGSTDTLSNGQKADLEAAQRLAKRLY- 313 eteGLdKkaiGefLGenddfniqvLneFvkNlFdFtglpLdeALRlfLks +++G++K++++++LG+n+df++ v++e++k +F+Ftg++Ld+ALR+fLk+ mKIAA2011 314 RLDGFRKADVARHLGKNNDFSKLVAGEYLK-FFVFTGMTLDQALRVFLKE 362 FRLPGEaQkIdRileaFSerYiqcQyNpgvfsnkkaEDdIecvqpdaDsa ++L+GE+Q+++R+l++FS+rY+qc Np+++s++ D+a mKIAA2011 363 LALMGETQERERVLAHFSQRYFQC--NPEALSSE-------------DGA 397 yvLsYSlIMLNTDLHNNpqVKkKkikMTledFieNnrrdLREENEYEELg ++L+++l++LNTDLH +++++k+ MT++dFi+N++ g mKIAA2011 398 HTLTCALMLLNTDLH-GHNIGKR---MTCGDFIGNLE------------G 431 indGgDlprefLtelYesIkneei<-* +ndGgD+pre+L++lY+sIkne++ mKIAA2011 432 LNDGGDFPRELLKALYSSIKNEKL 455 PH: domain 1 of 1, from 504 to 616: score 75.4, E = 1.2e-18 *->vikeGwLlkkg...........gkkswkkRyfvLfndvLlyykdkk. v+k+G L +k + +++ +++++gk++wk + +L++ L++ k++ + mKIAA2011 504 VYKHGALVRKVhadpdcrktprGKRGWKSFHGILKGMILYLQKEEYq 550 .......kkpkgsipLsgiqvekvpdn.krkncFeirt.dretlllqaes +++ +++++k i++ ++ ++++d++kr+++F++rt d++++l+qa+s mKIAA2011 551 pgkalseAELKNAISIHHALATRASDYsKRPHVFYLRTaDWRVFLFQAPS 600 eeerkeWvkaiqsair<-* e++++W++ i+ +++ mKIAA2011 601 LEQMQSWITRINVVAA 616 //