hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpg/mpg00908/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1994 ( 1058 res) mpg00908 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TSC22 TSC-22/dip/bun family 152.9 5.6e-42 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TSC22 1/1 973 1032 .. 1 60 [] 152.9 5.6e-42 Alignments of top-scoring domains: TSC22: domain 1 of 1, from 973 to 1032: score 152.9, E = 5.6e-42 *->MDLVKsHLmyAVREEVEvLkeqIkeLveklnqLeeENtLLktnvSpE MDLVKsHLmyAVREEVEvLkeqIkeL+ek++qLe+EN LLkt++SpE mKIAA1994 973 MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPE 1019 qLaqlqaqlqlae<-* qLaq+qaqlq+++ mKIAA1994 1020 QLAQFQAQLQTGS 1032 //