hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbp/mbp99003/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1983 ( 426 res) mbp99003 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- EGF_CA Calcium binding EGF domain 43.0 6.7e-09 1 EGF EGF-like domain 28.6 0.00014 2 Collagen Collagen triple helix repeat (20 copies) 12.4 0.00037 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- EGF 1/2 112 151 .. 1 39 [] 5.9 5 EGF 2/2 157 193 .. 1 39 [] 30.6 3.6e-05 EGF_CA 1/1 153 193 .. 1 55 [] 43.0 6.7e-09 Collagen 1/1 255 314 .. 1 60 [] 12.4 0.00037 Alignments of top-scoring domains: EGF: domain 1 of 2, from 112 to 151: score 5.9, E = 5 *->CspnngpCsngGtCvdtpggytCeCppGdyfll......ytGkrC<- C++ pC +C+d g C C pG y+++++++++ ++C mKIAA1983 112 CAQA--PCEQ--QCTDNFGRVLCTCYPG-YRYDrerhqkRERPYC 151 * mKIAA1983 - - EGF: domain 2 of 2, from 157 to 193: score 30.6, E = 3.6e-05 *->Cspnn.gpCsngGtCvdtpggytCeCppGdyfllytGkrC<-* C+ n+ C + +C++t g+y+CeC +G y l+ +G++C mKIAA1983 157 CATSNtTLCAH--ICINTMGSYHCECREG-YILEDDGRTC 193 EGF_CA: domain 1 of 1, from 153 to 193: score 43.0, E = 6.7e-09 *->DvDECat.gtlhvCpDpdentvCvNtiGSFeCvarkdCpeGYeVpvs D+DECat+ t C + +C+Nt GS+ C+ C+eGY mKIAA1983 153 DIDECATsNT-TLC-----AHICINTMGSYHCE----CREGYI---- 185 ennedgtnC<-* +dg +C mKIAA1983 186 -LEDDGRTC 193 Collagen: domain 1 of 1, from 255 to 314: score 12.4, E = 0.00037 *->GppGppGppGppGppGppGppGpaGapGppGppGepGpPGppGppGp G + ++ + +pGppG pG +Gp+G+pGp+G pG+pG PGppG+pGp mKIAA1983 255 GDKVLASNAYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGP 301 pGppGapGapGpp<-* +G G+ G+ mKIAA1983 302 RGSMGPMGPSPDL 314 //