hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mph/mph01546/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1977 ( 649 res) mph01546 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 133.8 1.8e-35 6 SAM Sterile alpha motif. 53.0 3.9e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/6 52 82 .. 1 30 [] 9.9 2.2e+02 ANK 2/6 86 115 .. 1 30 [] 30.9 0.00017 ANK 3/6 119 148 .. 1 30 [] 27.7 0.0016 ANK 4/6 152 181 .. 1 30 [] 29.6 0.00044 ANK 5/6 186 215 .. 1 30 [] 31.0 0.00017 ANK 6/6 219 248 .. 1 30 [] 4.9 1e+03 SAM 1/1 440 506 .. 1 67 [] 53.0 3.9e-11 Alignments of top-scoring domains: ANK: domain 1 of 6, from 52 to 82: score 9.9, E = 2.2e+02 *->dGrTpLHlAaengnlevvklLldkga.dina<-* d LH Aa+ g++evvk+ +++g d+n+ mKIAA1977 52 DVPLDLHTAASIGQHEVVKECVQRGElDLNK 82 ANK: domain 2 of 6, from 86 to 115: score 30.9, E = 0.00017 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+T+L++A + g+ +v+lLl++g+++n+ mKIAA1977 86 GGWTALMYASYIGHDTIVHLLLEAGVSVNV 115 ANK: domain 3 of 6, from 119 to 148: score 27.7, E = 0.0016 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+TpL+lA + gn++++ +Ll+ ga++++ mKIAA1977 119 EGQTPLMLASSCGNESIAYFLLQQGAELEM 148 ANK: domain 4 of 6, from 152 to 181: score 29.6, E = 0.00044 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+T+L ++ + g+ +vk+Ll++ga+ n+ mKIAA1977 152 HGWTALFHCTSAGHQQMVKFLLESGANANV 181 ANK: domain 5 of 6, from 186 to 215: score 31.0, E = 0.00017 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+TpL+ Aa++g++ +v+++l++g+ ++ mKIAA1977 186 YGYTPLMEAAASGHEIIVQYFLNHGVKVDT 215 ANK: domain 6 of 6, from 219 to 248: score 4.9, E = 1e+03 *->dGrTpLHlAaengnlevvklLldkgadina<-* G T+ +lA + g++++v l+ +++ + + mKIAA1977 219 SGATACMLARQFGHMKIVALMETHSPVLPK 248 SAM: domain 1 of 1, from 440 to 506: score 53.0, E = 3.9e-11 *->vs.wspesVaeWLesigleqYadnFrkngidgeelllltseedLkel + + + ++a Le ig+ +Y F+++ id +++l lt e+dLke+ mKIAA1977 440 PYsGPQQDLATLLEQIGCLKYLQVFEEQDIDLRIFLTLT-ESDLKEI 485 GitllGhRkkIlsaiqklkeq<-* Gitl G+ +k sai ++ mKIAA1977 486 GITLFGPKRKMTSAIARWHSS 506 //