hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbh/mbh03993/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1976 ( 328 res) mbh03993 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DEATH DEATH domain, found in proteins involved in 81.4 1.1e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DEATH 1/1 235 326 .. 1 108 [] 81.4 1.1e-19 Alignments of top-scoring domains: DEATH: domain 1 of 1, from 235 to 326: score 81.4, E = 1.1e-19 *->pagaaslteltreklaklldhpldlgddWreLArkLglseaeidqie +++a++++ l+r+k+++ ld+p+++g+dWr+LA+kL+l ++++ +++ mKIAA1976 235 GPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKLHL-DSHLSFFA 280 tesprelnAyyeddlreqsyqlLrlWeqregkneqatlgtLleaLrkmgr ++++ ++ ++L+lWe+r+ +n ++lg+L++a +g mKIAA1976 281 SKPS-------------PTAMILNLWEARHFPN--GNLGQLAAAVAGLGQ 315 ddavellrsel<-* da + se mKIAA1976 316 PDAGLFTVSEA 326 //