hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh03993/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1976 ( 328 res) mbh03993 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Death Death domain 71.5 1.8e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Death 1/1 247 326 .. 1 87 [] 71.5 1.8e-17 Alignments of top-scoring domains: Death: domain 1 of 1, from 247 to 326: score 71.5, E = 1.8e-17 *->eklcallDpdellgkdWkeLArkLglseneIdeiesdenpgdlrspt +k++ +lDp++ g+dW++LA+kL+l ++++ ++ s ++ spt mKIAA1976 247 QKIITSLDPPCSRGADWRTLAQKLHL-DSHLSFFAS-KP-----SPT 286 yeLLrlWeqrhGknatvgtLleaLrklgrrdaaellesal<-* ++L+lWe+rh +n+++g+L++a lg+ da s++ mKIAA1976 287 AMILNLWEARHFPNGNLGQLAAAVAGLGQPDAGLFTVSEA 326 //