hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mek/mek00570/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1952 ( 309 res) mek00570 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- hATC hAT family dimerisation domain 18.4 0.0025 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- hATC 1/1 228 308 .. 1 94 [] 18.4 0.0025 Alignments of top-scoring domains: hATC: domain 1 of 1, from 228 to 308: score 18.4, E = 0.0025 *->ELdkYlselpvlprnteprgledfdvLeWWkeaqnssryPiLsklAr E+ +Yl+e p+++ + d+ ++W+ + ++ L klA+ mKIAA1952 228 EVYDYLQE-PLFQATP--------DLFQYWS--CVTQKHTKLAKLAF 263 diLsiPvssaasErsFStgklgrvldesrnrlepenveaLlcledwl<-* +L++P+ a s + +l ++r+ l pe ++L++l++++ mKIAA1952 264 WLLAVPAVGARSGCVNMCE--QALLIKRRRLLSPEDMNKLMFLKSNM 308 //