hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg08812/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1916  ( 588 res)   mbg08812

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
EPTP     EPTP domain                                    188.3    1.2e-52   3
LRR_1    Leucine Rich Repeat                             43.7    4.3e-09   5

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
LRR_1      1/5     105   128 ..     1    25 []     0.1  1.9e+03
LRR_1      2/5     129   152 ..     1    25 []    11.1       27
LRR_1      3/5     153   176 ..     1    25 []    15.6      1.2
LRR_1      4/5     177   200 ..     1    25 []    14.8        2
LRR_1      5/5     201   224 ..     1    25 []     6.7  1.5e+02
EPTP       1/3     263   303 ..     1    44 []    90.6  3.2e-23
EPTP       2/3     451   492 ..     1    44 []    91.2  2.1e-23
EPTP       3/3     496   536 ..     1    44 []     8.9      0.3

Alignments of top-scoring domains:
LRR_1: domain 1 of 5, from 105 to 128: score 0.1, E = 1.9e+03
                   *->nLeeLdLsgCNpslsgslpps.l.glp<-*
                       + +L+L +    +  ++ +  +++lp   
   mKIAA1916   105    DISSLSLVN-G-TFL-EIKDRmFsHLP    128  

LRR_1: domain 2 of 5, from 129 to 152: score 11.1, E = 27
                   *->nLeeLdLsgCNpslsgslpps.l.glp<-*
                      +L+ L L++ N s++  + ++++ gl    
   mKIAA1916   129    SLQLLLLNS-N-SFT-VIRDDaFaGLF    152  

LRR_1: domain 3 of 5, from 153 to 176: score 15.6, E = 1.2
                   *->nLeeLdLsgCNpslsgslpps.l.glp<-*
                      +Le+L ++g N +++ +++ ++++gl+   
   mKIAA1916   153    HLEYLFIEG-N-KIE-TISRNaFrGLR    176  

LRR_1: domain 4 of 5, from 177 to 200: score 14.8, E = 2
                   *->nLeeLdLsgCNpslsgslpps.l.glp<-*
                       L++L+L + N ++ + lp + +++l    
   mKIAA1916   177    DLTHLSLAN-N-HI-KALPRDvFsDLD    200  

LRR_1: domain 5 of 5, from 201 to 224: score 6.7, E = 1.5e+02
                   *->nLeeLdLsgCNpslsgslpps.l.glp<-*
                      +L eLdL+g N +++ +  + ++  l    
   mKIAA1916   201    SLIELDLRG-N-KFE-CDCKAkWlYLW    224  

EPTP: domain 1 of 3, from 263 to 303: score 90.6, E = 3.2e-23
                   *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-*
                      Fv+hq+lP  +++++v++F++++DvY+a+aqp+++ +++vl+Wd   
   mKIAA1916   263    FVVHQTLP--YQSVSVDTFNSKNDVYVAIAQPSME-NCMVLEWD    303  

EPTP: domain 2 of 3, from 451 to 492: score 91.2, E = 2.1e-23
                   *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-*
                      Fv+h+d+Pn+edvlavk+F++++++YL+L+++ig  dS+v+rW+   
   mKIAA1916   451    FVPHGDIPNMEDVLAVKSFRMQNTLYLSLTRFIG--DSRVMRWN    492  

EPTP: domain 3 of 3, from 496 to 536: score 8.9, E = 0.3
                   *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-*
                      Fv  q lP  +++ +  +Fs +   YLaL    +   S +  Wd   
   mKIAA1916   496    FVEVQALP-SRGAMTLQPFSFKDNHYLALGSDYT--FSQIYQWD    536  

//