hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mng/mng06308/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1903 ( 827 res) mng06308 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding d 34.3 1.6e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SANT 1/1 571 623 .. 1 53 [] 34.3 1.6e-05 Alignments of top-scoring domains: SANT: domain 1 of 1, from 571 to 623: score 34.3, E = 1.6e-05 *->kkgeWteeEdelLleavkkyGkgtdndWakIakelpgRtpkqcrerw + +eW+e+E ++L +a ++k +++ W+ +a +++Rt+ +c++++ mKIAA1903 571 DDEEWSEQELQKLHCAFTSLPKHKPGFWSDVAMAVGSRTADECQKKY 617 rnllkp<-* + mKIAA1903 618 TEEPQG 623 //