hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh02730/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1891 ( 1086 res) mbh02730 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UCH Ubiquitin carboxyl-terminal hydrolase 185.3 9.5e-52 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- UCH 1/1 486 990 .. 1 273 [] 185.3 9.5e-52 Alignments of top-scoring domains: UCH: domain 1 of 1, from 486 to 990: score 185.3, E = 9.5e-52 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx *->pgptGLvNlGNTCYmNSvLQcLfhipplrdyllsdsyeseinesnpl +g tGL+NlGNTCYmNSvLQ+Lf+ ++r+ +ls l mKIAA1891 486 TGKTGLINLGNTCYMNSVLQALFMATEFRRQVLSL----------NL 522 RF xxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxxxxxxxx gskgsllcaladLfnalqsg.yksvvpsplkflqfkttlgkineefsgym +sl + l+ Lf+ l + ++ +p+ ++ +++ + f ++ mKIAA1891 523 NGCNSLMKKLQHLFAFLAHTqREAYAPRIFFE-------ASRPPWFTPRS 565 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx x xxxxx QqDAhEFllfLLdgLhedlnrvnkkpytepe.s............dkrpd QqD+ E+l+fLLd+Lhe+ + + + ++p++ + ++ ++ ++k+ + mKIAA1891 566 QQDCSEYLRFLLDRLHEEEKILRVQSSHKPSeGldcaetclqevtSKVAV 615 RF xxx xxxxxxxxxxxxxxxxxxxxxxxx .kaa.eawknhslrneslitdlFqGqles..................... + +++ ++ + +li + F+G+l+++ ++ ++++++++ + ++ + mKIAA1891 616 pTESpGTGDSEK----TLIEKMFGGKLRThicclncgstshkveaftdls 661 RF .................................................. +++++ ++ + +++ + ++ ++++ +++ ++++++ ++ + mKIAA1891 662 lafcpspsvedlsfqdtaslpsaqddglmqtsvadpeeepvvynpataaf 711 RF .................................................. +++ +++ ++++ + ++ ++++ ++++ + +++ +++++++++++ mKIAA1891 712 vcdsvvnqrvlgsppvefhcaesssvpeesariliskdvpqnpggestts 761 RF xxxxxxxxxxxxxxxxx .................................rlkisrLPpiLiihLKR ++ + ++ +++++ ++++ + ++ +++++i+ P++Li+ L R mKIAA1891 762 vtdllnyflapevltgenqyycescaslqnaekTMQITEEPEYLILTLLR 811 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx FkydgetgmnkKindkVefPleLdlssyctae.................. F+yd ++Ki d+V+ Pl L l +ta+ ++ +++ + + + ++ + mKIAA1891 812 FSYDQKYHVRRKILDNVSLPLVLELPVKRTASfsslsqswsvdvdftdin 861 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxx ..................pplkYeLyaVvvHsGsslsgGHYiayikk... ++ +++ +++++++ ++ Y L +VvvHsG+s+++GHY++y+++ ++ mKIAA1891 862 enlpkklkpsgteeafcpKLVPYLLSSVVVHSGVSSESGHYYSYARNitg 911 RF xxxxxxxxxxx .......................................kkknnkWykfD ++++ + +++++ ++++ + +++++ +++ ++k ++W++f+ mKIAA1891 912 tessyqmcpqseslalapsqscllgvespntvieqdlenKEMSQEWFLFN 961 RF xxxxxxxxxxxxxx xxxxxxxxxx DekVsevseeevle.....rsssAYiLFY<-* D++V+ s v++ +++ +++AY+L+Y mKIAA1891 962 DSRVTFTSFQSVQKitsrfPKDTAYVLLY 990 //