hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg03386/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1862  ( 1098 res)   mbg03386

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
KRAB     krueppel associated box                         73.5    2.7e-17   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
KRAB       1/1      27    89 ..     1    62 []    73.5  2.7e-17

Alignments of top-scoring domains:
KRAB: domain 1 of 1, from 27 to 89: score 73.5, E = 2.7e-17
                   *->VtFeDVAVdFsqEEWeqLDpaQrnLYRdVMlENYsnLvSLGgfqvsk
                       +F+D AV Fs+EEW++L   Qr++YRdVM+ENY++LvS+G  +   
   mKIAA1862    27    ISFKDLAVRFSEEEWRLLQEGQREFYRDVMRENYETLVSVG-TSELL 72   

                   p..dliskLEqgeEpwi<-*
                   p + ++s  E g        
   mKIAA1862    73 PlsAFLSPAEAGGATSG    89   

//