hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg03386/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1862 ( 1098 res) mbg03386 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- KRAB KRAB box 80.9 2.6e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- KRAB 1/1 27 67 .. 1 41 [] 80.9 2.6e-20 Alignments of top-scoring domains: KRAB: domain 1 of 1, from 27 to 67: score 80.9, E = 2.6e-20 *->VtFeDVAVdFtqEEWglLdpaQrnLYrdVMlENyrnLvSlg<-* +F+D AV F++EEW+lL + Qr++YrdVM+ENy++LvS+g mKIAA1862 27 ISFKDLAVRFSEEEWRLLQEGQREFYRDVMRENYETLVSVG 67 //