hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mfj/mfj06075/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1847  ( 522 res)   mfj06075

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
G-patch  glycine rich nucleic binding domain             47.2    2.1e-09   1
ZnF_C3H1 zinc finger                                     28.1     0.0013   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
ZnF_C3H1   1/1     206   231 ..     1    31 []    28.1   0.0013
G-patch    1/1     343   389 ..     1    48 []    47.2  2.1e-09

Alignments of top-scoring domains:
ZnF_C3H1: domain 1 of 1, from 206 to 231: score 28.1, E = 0.0013
                   *->kyktelCkfFarrGppgyCpyGdrCkfaHpl<-*
                      k+  ++C+fF + G    C++ ++C+f+H+    
   mKIAA1847   206    KSL-KPCPFF-LEG---KCRFKENCRFSHGQ    231  

G-patch: domain 1 of 1, from 343 to 389: score 47.2, E = 2.1e-09
                   *->istsniGaklLekMGWkeGkGLGkneqGivePIeakikkkdrkGLGa
                      ++t +iG klL kMG++ GkGLG++ +G+vePI+a +   ++k L  
   mKIAA1847   343    VHTRGIGSKLLVKMGYEFGKGLGRHAEGRVEPIHAVVL-PRGKSLDQ 388  

                   v<-*
                       
   mKIAA1847   389 C    389  

//