hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj06075/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1847 ( 522 res) mfj06075 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- G-patch G-patch domain 54.0 3.4e-12 1 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and simil 24.2 0.0031 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- zf-CCCH 1/1 206 231 .. 1 27 [] 24.2 0.0031 G-patch 1/1 345 389 .. 1 45 [] 54.0 3.4e-12 Alignments of top-scoring domains: zf-CCCH: domain 1 of 1, from 206 to 231: score 24.2, E = 0.0031 *->yktelCrffsrtGtCkyGdrCkFaHge<-* + ++C+ff++ G C++ ++C+F+Hg+ mKIAA1847 206 KSLKPCPFFLE-GKCRFKENCRFSHGQ 231 G-patch: domain 1 of 1, from 345 to 389: score 54.0, E = 3.4e-12 *->tsniGfklLqKMGWkeGqGLGkneqGikePieakikpdraGLGae<- t++iG+klL KMG++ G+GLG++ +G++ePi a++ p++++L mKIAA1847 345 TRGIGSKLLVKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQC 389 * mKIAA1847 - - //