hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mia/mia34065/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1844 ( 569 res) mia34065 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- WW WW domain 40.2 4.5e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- WW 1/1 157 186 .. 1 30 [] 40.2 4.5e-08 Alignments of top-scoring domains: WW: domain 1 of 1, from 157 to 186: score 40.2, E = 4.5e-08 *->LppgWeerkdpdGrpYYyNhnTktTqWekP<-* + W e+++++G++YYyN T +qWekP mKIAA1844 157 SADDWSEHISSSGKKYYYNCRTEVSQWEKP 186 //