hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj01581/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1839 ( 462 res) mfj01581 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or 35.8 9.8e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RRM_1 1/1 368 444 .. 1 74 [] 35.8 9.8e-07 Alignments of top-scoring domains: RRM_1: domain 1 of 1, from 368 to 444: score 35.8, E = 9.8e-07 *->lfVgNLppdtteedLkdlFskfGpi..esikivrD.ttretgrskGf ++V+NL + + e+dLk +F+ + ++++e +i+ D + gr kG mKIAA1839 368 IYVKNLARHVQEKDLKFIFGRYVDFssETQRIMFDiRLMKEGRMKGQ 414 aFVeFedeedAekAldalnGkelggrelrv<-* aFV +e +A+kAl++ nG+ l g+++ v mKIAA1839 415 AFVGLPNEKAAAKALKEANGYVLFGKPMVV 444 //