hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mpg/mpg00446/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1795  ( 531 res)   mpg00446

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
HTH_psq  helix-turn-helix, Psq domain                    66.9    4.4e-16   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
HTH_psq    1/1     448   493 ..     1    48 []    66.9  4.4e-16

Alignments of top-scoring domains:
HTH_psq: domain 1 of 1, from 448 to 493: score 66.9, E = 4.4e-16
                   *->teedlaeAieavrknGkimSirkAArkYGiPrsTLygrrlrggislk
                        e l+eAi+ v+ +Gk mS++kA ++YGiP+sTL+++++++ ++lk
   mKIAA1795   448    NSEILEEAISVVM-SGK-MSVSKAQSIYGIPHSTLEYKVKERLGTLK 492  

                   r<-*
                   +   
   mKIAA1795   493 N    493  

//