hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mph/mph01357/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1785 ( 617 res) mph01357 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 203.8 1.6e-56 9 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/9 2 31 .. 1 30 [] 2.8 2e+03 ANK 2/9 40 70 .. 1 30 [] 30.3 0.00027 ANK 3/9 82 111 .. 1 30 [] 26.1 0.0047 ANK 4/9 115 144 .. 1 30 [] 27.4 0.0019 ANK 5/9 148 177 .. 1 30 [] 38.0 1.3e-06 ANK 6/9 181 210 .. 1 30 [] 27.7 0.0016 ANK 7/9 213 243 .. 1 30 [] 15.1 10 ANK 8/9 481 523 .. 1 30 [] 15.1 9.8 ANK 9/9 527 556 .. 1 30 [] 33.3 3.2e-05 Alignments of top-scoring domains: ANK: domain 1 of 9, from 2 to 31: score 2.8, E = 2e+03 *->dGrTpLHlAaengnlevvklLldkgadina<-* d +T+ Aa+ g l ++ Ll ++ ++ mKIAA1785 2 DLKTAVFNAARDGKLRLLTKLLASKSKAEV 31 ANK: domain 2 of 9, from 40 to 70: score 30.3, E = 0.00027 *->dGrTpLHlAaengnlevvklLldkga.dina<-* +G TpL +Aa++g+l++v++Ll+ +i++ mKIAA1785 40 NGATPLLMAARYGHLDMVEFLLEQCSaSIEV 70 ANK: domain 3 of 9, from 82 to 111: score 26.1, E = 0.0047 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G pL+ A + g+l+vv+ Ll++ga++n mKIAA1785 82 EGAPPLWAASAAGHLKVVQSLLNHGASVNN 111 ANK: domain 4 of 9, from 115 to 144: score 27.4, E = 0.0019 *->dGrTpLHlAaengnlevvklLldkgadina<-* + TpL A+ g+le+vk+L++++ad+++ mKIAA1785 115 TNSTPLRAACFDGHLEIVKYLVEHKADLEV 144 ANK: domain 5 of 9, from 148 to 177: score 38.0, E = 1.3e-06 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+T+L++ +++g++e++++Ll+kgad+n mKIAA1785 148 HGHTCLMISCYKGHKEIAQYLLEKGADVNR 177 ANK: domain 6 of 9, from 181 to 210: score 27.7, E = 0.0016 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+T+LH +ae+g+l+++k+Ll + a +++ mKIAA1785 181 KGNTALHDCAESGSLDIMKMLLMYCAKMEK 210 ANK: domain 7 of 9, from 213 to 243: score 15.1, E = 10 *->dGrTpLHlAaengnlevvklLldkga.dina<-* +G+TpL A +g+ ++v +L + ++ ++ mKIAA1785 213 YGMTPLLSASVTGHTNIVDFLTHHAQtSKTE 243 ANK: domain 8 of 9, from 481 to 523: score 15.1, E = 9.8 *->dGrTpLHlAaen.............gnlevvklLldkgadina<-* ++++pLHlA+ ++++ ++ + + +l v +L++ gad+n+ mKIAA1785 481 NNFSPLHLAVDKnttcvgrypvckfPSLQVTAILIECGADVNV 523 ANK: domain 9 of 9, from 527 to 556: score 33.3, E = 3.2e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* d+++pLH+Aa n+++++++lL+++ga ++a mKIAA1785 527 DDNSPLHIAALNNHPDIMNLLIKSGAHFDA 556 //