hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg06236/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1777 ( 502 res) mbg06236 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ZU5 Domain present in ZO-1 and Unc5-like netrin 84.5 1.3e-20 1 DEATH DEATH domain, found in proteins involved in 51.8 8.7e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ZU5 1/1 89 191 .. 1 115 [] 84.5 1.3e-20 DEATH 1/1 396 487 .. 1 108 [] 51.8 8.7e-11 Alignments of top-scoring domains: ZU5: domain 1 of 1, from 89 to 191: score 84.5, E = 1.3e-20 *->psflvsgtvdsrGGrLrgprHsGvrliiPpgAipqGtryecYlvvhk + g ++ +GGrL p+ +Gv+l+iP gAip+ e+Y +++ mKIAA1777 89 TELRTTGVFGHLGGRLVMPN-TGVSLLIPHGAIPEENSWEIYMSINQ 134 klstpPPLDkeegEtLLSPvvecGPCDVSmSAhGalllrPViLevpHCAs + P L ++E LLSP v+cGP ++ l + P L++pHCA+ mKIAA1777 135 GE---PSLQSDGSEVLLSPEVTCGP-------PDMLVTTPFALTIPHCAD 174 lrprdkwelvllrsengg<-* ++ + w + l++ +g mKIAA1777 175 VSSEH-WNIHLKKRTQQG 191 DEATH: domain 1 of 1, from 396 to 487: score 51.8, E = 8.7e-11 *->pagaaslteltreklaklldhpldlgddWreLArkLglseaeidqie ++ a++++ +r++++ d p+ +g+dW+ LA+k+ + +++ +++ mKIAA1777 396 GPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSI-NRNLSYFA 441 tesprelnAyyeddlreqsyqlLrlWeqregkneqatlgtLleaLrkmgr t+s+ +s ++L+lWe+r+ + + l+ L+ aL+++gr mKIAA1777 442 TQSS-------------PSAVILNLWEARHQQD--GDLDSLACALEEIGR 476 ddavellrsel<-* + + +e mKIAA1777 477 THTKLSNITEP 487 //