hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg06236/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1777 ( 502 res) mbg06236 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ZU5 ZU5 domain 87.6 2.6e-22 1 Death Death domain 62.7 8e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ZU5 1/1 89 191 .. 1 107 [] 87.6 2.6e-22 Death 1/1 408 485 .. 1 87 [] 62.7 8e-15 Alignments of top-scoring domains: ZU5: domain 1 of 1, from 89 to 191: score 87.6, E = 2.6e-22 *->tsflvsgtfdarGGsLrgprHtGVsiiIPpgaipqgtrytcylvkhk t g f+ +GG+L p+ tGVs++IP gaip+ ++y +++ mKIAA1777 89 TELRTTGVFGHLGGRLVMPN-TGVSLLIPHGAIPEENSWEIYMSINQ 134 kestpPPlDkeegetLlSpiVecGPtGalFlrPViLevPHcAslrpkewe e P l ++e LlSp V+cGP++ l + P L++PHcA+++ + w mKIAA1777 135 GE---PSLQSDGSEVLLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWN 181 lvlLrsdngg<-* + l++ +g mKIAA1777 182 IHLKKRTQQG 191 Death: domain 1 of 1, from 408 to 485: score 62.7, E = 8e-15 *->eklcallDpdellgkdWkeLArkLglseneIdeiesdenpgdlrspt +++ca +D ++ gkdW+ LA+k+ + ++ + ++ + ++ sp+ mKIAA1777 408 QRICATFDTPNAKGKDWQMLAQKNSI-NRNLSYFAT-QS-----SPS 447 yeLLrlWeqrhGknatvgtLleaLrklgrrdaaellesal<-* +L+lWe+rh ++++++ L++aL+++gr ++ +l ++ mKIAA1777 448 AVILNLWEARHQQDGDLDSLACALEEIGRTHT--KLSNIT 485 //