hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpm/mpm03353/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1735 ( 484 res) mpm03353 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DAX Domain present in Dishevelled and axin 84.1 1.7e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DAX 1/1 399 481 .. 1 86 [] 84.1 1.7e-20 Alignments of top-scoring domains: DAX: domain 1 of 1, from 399 to 481: score 84.1, E = 1.7e-20 *->csetKViYhlDdEetPYlvkvpvpaervTLgdFKevLtkkgnYKYYf + tKV Y+ D tP +v +p + + vTL dFK++ + gn +Y f mKIAA1735 399 STCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDREGNHRYHF 445 KslDdDfgCgvVKeEirdDsarLrPcfNGrvvswLvsve<-* K+lD++f g VKeE++ D + P +G++v w++ mKIAA1735 446 KALDPEF--GTVKEEVFHDDDAI-PGWEGKIVAWVEEDH 481 //