hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mtk/mtk00096/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1732 ( 704 res) mtk00096 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- WW 53.2 3.4e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- WW 1/1 530 562 .. 1 34 [] 53.2 3.4e-11 Alignments of top-scoring domains: WW: domain 1 of 1, from 530 to 562: score 53.2, E = 3.4e-11 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* lPp+W+ + dp+ G++YYy+++T++tqW++P++ mKIAA1732 530 VLPPNWKTARDPE-GKIYYYHVITRQTQWDPPTW 562 //